Bioinformatica

Solo disponible en BuenasTareas
  • Páginas : 5 (1008 palabras )
  • Descarga(s) : 0
  • Publicado : 31 de agosto de 2010
Leer documento completo
Vista previa del texto
Ejercicio de Bioinformatica

El propósito de este ejercicio es utilizar sus nuevas habilidades para el diseño de varias construcciones y para añadir nuevos conocimientos a lo largo del camino de elaboración de este ejercicio.

PROBLEMA

Ud. está estudiando una importante proteína de la membrana bacteriana, de una bacteria causante de enfermedades en humanos para crear una vacunarecombinante y de esa forma contribuir en el mundo científico con su gran aporte a la humanidad.

 Usted por medio de métodos de bioinformática, logró identificar un fragmento de la secuencia de la proteína (ver fig. 1) que es probablemente la que puede formar el dominio soluble de la proteína particula necesaria para la elaboración dela vacuna.

FIGURA 1. SECUENCIA DE DOMINIO SOLUBLE DE LA PROTEINACTTCTTTTTCTGTAGGCTATAACCATTTTTTTAGGAATGGTATGTCATTGACTTTAAATT

TATCGAAGACACAGAATATCAATAAGTATGGAGAAAAAACTAGTGAGCTATTATCTAATA

TCTGGTTGAGTTTTCCTCTCAGTCGCTGGCTAGGTAATAACTCAATAAATTCAAATTACC

AAATGACATCAGATTCTCATGGTAACACTACCCATGAGGTA

Preguntas:
1. Traduzca la secuencia del dominio soluble de la proteína usando el programa GENERUNNER. El resultado colóquelo como una foto que le tome a lapantalla
[pic]

2. Realícele un BLAST de proteína y diga a que proteína se parece más y a que microorganismo pertenece. ¿que función posee esta proteína?. El resultado del BLAST colóquelo como foto de pantalla. Muestre el numero de acceso para esta secuencia
[pic]
Proteína : putative F1 capsule anchoring protein
Organism: Yersinia pestis
Function:
Numero de acceso : ACY60663.13. Después tomar la decisión a que organismo pertenece, Cual es la secuencia completa de la proteína?. El resultado colóquelo como una foto que le tomo a la pantalla donde encontró la secuencia completa de la proteína. Luego Indique si el fragmento del dominio soluble pertenece a la región central, a la inicial o a la carboxi-terminal.
[pic]MLDTNSGESIDVSLFNQGLQLPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSS

LQLTKYGIDIDKYPDLIKSGTEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPRFDGI

MPMQLWDDGIPALFMNYNTNMQTRKFREGGKSLDSYYAQLQPGLNIGAWRFRSSTSWWKQ

QGWQRSYIYAERGLNTIKSRLTLGETYSDSSIFDSIPIKGIKIASDESMVPYYQWNFAPV

VRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPLGGGSGELKVIIHESDGTKQVFTV

PYDTPAVALRKGYFEYSMMGGEYRPANDLTQTSYVGALGMKYGLPRNLTLYGGLQGSQNY

HAAALGIGAMLGDFGAISTDVTQADSQKNKQKKESGQRWRVRYNKYLQSGTSLNIASEEYATEGFNKLADTLNTYCKPNTRNDCRFDYAKPKNKVQFNLSQSIPGSGTLNFSGYRKNYWR

DSRSTTSFSVGYNHFFRNGMSLTLNLSKTQNINKYGEKTSELLSNIWLSFPLSRWLGNNS

INSNYQMTSDSHGNTTHEVGVYGEAFDRQLYWDVRERFNEKGRKYTSNALNLNYRGTYGE

ISGNYSYDQTQSQLGIGVNGNMVITQYGITAGQKTGDTIALVQAPDISGASVGYWPGMKT

DFRGYTNYGYLTPYRENKVEINPVTLPNDAEITNNIVSVIPTKGAVVLAKFNARIGGRLF

LHLKRSDNKPVPFGSIVTIEGQSSSSGIVGDNSGVYLTGLPKKSKILVKWGRDKNQSCSSNVVLPEKTDISGAYRLSTTCILNN

Pertenece a la región central.

4. Luego de hallar la secuencia completa de la proteína, en el programa GENERUNNER halle la secuencia del DNA de esa proteína. El resultado colóquelo como una foto que le tome a la pantalla. Explique qué significa la presencia de las letras M, N,Y,R,W, S. Por que aparecen varias secuencias para un mismo a.a ?. Cree ud que se podría determinarexactamente cual es la secuencia de DNA para esa proteína partiendo únicamente de la secuencia de los a.a explique?
[pic]

a. Las letras M,N,Y,R,S ,W SON CODONES COMODINES QUE REPRESENTAN LO DIFERENTES CODONES QUE PUEDEN CODIFICAR PARA ESE AMINOACIDO.
b. Debido a que el código genético es degenerado un aminoácido puede ser codificado por más de un codón.
c. No porque como ya se menciono unaminoácido puede ser codificado por diferentes codones y con solo esa información no podríamos decir cual codón fue el que genero ese aminoácido

5. Busque la secuencia completa correcta del DNA para esa proteína a partir de la información obtenida del BLAST. LA respuesta colóquela como una foto que le tome a la pantalla
[pic]

6. Teniendo la secuencia completa del DNA diseñe un par de...
tracking img