Sp29. brucella

Solo disponible en BuenasTareas
  • Páginas : 7 (1528 palabras )
  • Descarga(s) : 0
  • Publicado : 21 de febrero de 2010
Leer documento completo
Vista previa del texto
Uso de herramientas computacionales para el análisis de dominios de la proteína Rib de bacterias del género Brucella

Introducción
La proteína Rib ha sido identificada como una proteína con propiedades de hemaglutinina que participa en la interacción de la bacteria Brucella con células eucariontes, mediante los residuos de ácido siálico, lo cual ha señalado su importancia en los procesosrelacionados con la virulencia [1].
La función de esta proteína puede ser asistida por herramientas computacionales que son de gran utilidad ya que la información obtenida es de relevancia para los sistemas biológicos estudiados. Adicionalmente, pueden incluirse el análisis y la predicción de mutaciones que confieran cambios en las características de las proteínas, como pueden ser su estabilidadtérmica o la especificidad a sus sustratos.
En estudios anteriores se modeló la estructura tridimensional de Rib mediante la estructura cristalográfica de 2IOY obtenida de T. tencongensis, la cual se une al azúcar ribosa. Se observó que Rib conserva una elevada homología, 32.7%, y se identificó una gran similitud en estructura terciaria de ambas proteínas.
Al analizar la secuencia FASTA de Ribmediante el programa protein-protein BLAST se realizará la búsqueda de dominios conservados para esa proteína debido a que se desconocen sus posibles funciones [2], las cuales pueden ser predichas al analizar la información recopilada de las bases de datos de dominios. Mediante el programa pdbviewer 4.1.0.[3] se analizarán las distancias de los aminoácidos del sitio activo de Rib de B. abortus y secompararán con los correspondientes en T. tencongensis para tener una idea aproximada de la posible función de Rib.

Desarrollo
1.- Se analizaron los dominios conservados de la proteína Rib mediante la secuencia FASTA, para lo cual se empleo la base de datos del CD-search.
2.- Se calcularon las distancias aproximadas de los aminoácidos del sitio activo de Rib mediante el programa pdbviewer4.1.0., y se compararon con las distancias de los aminoácidos de 2IOY ya calculadas previamente [4].

Resultados
1.- Búsqueda de dominios en B. abortus
La búsqueda de dominios para la proteína Rib llevada a cabo mediante el protein-protein BLAST y CD-search, con secuencia FASTA de B. abortus, >gi|189022569|ref|YP_001932310.1| Periplasmic binding protein/LacI transcriptional regulator[Brucella abortus S19] (MFKKGMRVLFAAAAALPLIASTAWAEGLMTIIVNDPSNPYWFTEGEVAKKTAEGLGYKAV

VGGHKGDTNTESNLIDTAITNKSVAIILDPANADGSVGAVKRAIAANIPVFLINAEINQE

GLAKAQLVSNNAQGAALGATQWVESVGDKGKYVELFGAPSDNNAATRSNGYETVLSQYPD

LVRVGKDVANWDRTQGHDKMQALLQANPDIIGVISGNDEMALGAIAALKKAGKLDQVKVG

GFDGSPDAIAAIKAGELQYTVLQPVAVFSEAAVKQADNFIKTGKTGVDHEKQLFDCILIT

KDNVDKYTSPFVLEQ), permitió identificar dominios de unión aazúcar que pertenecen a la familia de proteínas de unión periplásmica tipo I y que se encuentra en T. tengcongensis asociados a procesos de quimiotaxis, transportadores de unión a ATP y comunicación intercelular en el sistema nervioso central, dominios de receptores primarios involucrados en procesos de quimiotaxis, en el transporte de azúcares y factores transcripcionales de DNA como Lacl y GalRpresentes en bacterias y archeas, dominios de unión a azúcar periplásmicos tipo II que pertenecen a sistemas de transporte de tipo ABC, dominios de tipo ABC periplásmico en sistemas de transporte YtfO involucrados en el transporte de azúcares a través de la membrana y organelos, entre otros, por lo que Rib podría estar a asociada a múltiples funciones en Brucella.

1.1 Dominio DUF638
Resultó degran interés encontrar el dominio DUF638, el cual pertenece a UNA familia de proteínas bacterianas que posee una región conservada con función de hemaglutinina o hemolisina. Este grupo de proteínas, principalmente de Neisseria meningitidis, tiene actividad de hemaglutinina o hemolisina. La mayoría de estas proteínas tienen un segundo dominio conservado, el cual se ha encontrado en hemaglutininas...
tracking img