Peptidos anticancerigenos

Solo disponible en BuenasTareas
  • Páginas : 8 (1897 palabras )
  • Descarga(s) : 0
  • Publicado : 5 de marzo de 2012
Leer documento completo
Vista previa del texto
# | SwissProt ID | Nombre del péptido | Referencia | Secuencia |
1 | AP00001 | P31107 | Dermaseptin-B2 | http://aps.unmc.edu/AP/database/query_output.php?ID=00001 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV |
2 | AP00012 | P82386 | Aurein 1.1 | http://aps.unmc.edu/AP/database/query_output.php?ID=00012 | GLFDIIKKIAESI |
3| AP00013 | PBD: 1VM5 | Aurein 1.2 | http://aps.unmc.edu/AP/database/query_output.php?ID=00013 | GLFDIIKKIAESF |
4 | AP00014 | P82388 | Aurein 2.1 | http://aps.unmc.edu/AP/database/query_output.php?ID=00014 | GLLDIVKKVVGAFGSL |
5 | AP00015 | P82389 | Aurein 2.2 | http://aps.unmc.edu/AP/database/query_output.php?ID=00015| GLFDIVKKVVGALGSL |
6 | AP00016 | P82390 | Aurein 2.3 | http://aps.unmc.edu/AP/database/query_output.php?ID=00016 | GLFDIVKKVVGAIGSLGLFDIVKKVVGAFGSL |
7 | AP00017 | P82391 | Aurein 2.4 | http://aps.unmc.edu/AP/database/query_output.php?ID=00017 | GLFDIVKKVVGTLAGL |
8 | AP00018 | P82392 | Aurein 2.5 |http://aps.unmc.edu/AP/database/query_output.php?ID=00018 | GLFDIVKKVVGAFGSL |
9 | AP00019 | P82393 | Aurein 2.6 | http://aps.unmc.edu/AP/database/query_output.php?ID=00019 | GLFDIAKKVIGVIGSL |
10 | AP00020 | P82394 | Aurein 3.1 | http://aps.unmc.edu/AP/database/query_output.php?ID=00020 | GLFDIVKKIAGHIAGSI |
11 | AP00021 | P82395| Aurein 3.2 | http://aps.unmc.edu/AP/database/query_output.php?ID=00021 | GLFDIVKKIAGHIASSI |
12 | AP00022 | P82396 | Aurein 3.3 | http://aps.unmc.edu/AP/database/query_output.php?ID=00022 | GLFDIVKKIAGHIVSSI |
13 | AP00023 | P83477 | Antiviral protein Y3 | http://aps.unmc.edu/AP/database/query_output.php?ID=00023 |VYINKLTPPCGTMYYACEAV |
14 | AP00025 | P83412 | Alloferon 1  | http://aps.unmc.edu/AP/database/query_output.php?ID=00025 | HGVSGHGQHGVHG |
15 | AP00026 | PBD: 1LFC | Lactoferricin B | http://aps.unmc.edu/AP/database/query_output.php?ID=00025 | HGVSGHGQHGVHG |
16 | AP00035 | PBD: 1YTR | Plantaricin A |http://aps.unmc.edu/AP/database/query_output.php?ID=00035 | KSSAYSLQMGATAIKQVKKLFKKWGW |
17 | AP00058 | P83080 | Maximin 1 | http://aps.unmc.edu/AP/database/query_output.php?ID=00058 | GIGTKILGGVKTALKGALKELASTYAN |
18 | AP00060 | P83082 | Maximin 3 | http://aps.unmc.edu/AP/database/query_output.php?ID=00060 | GIGGKILSGLKTALKGAAKELASTYLH |
19 | AP00061| P83083 | Maximin 4 | http://aps.unmc.edu/AP/database/query_output.php?ID=00061 | GIGGVLLSAGKAALKGLAKVLAEKYAN |
20 | AP00062 | P83084 | Maximin 5 | http://aps.unmc.edu/AP/database/query_output.php?ID=00062 | SIGAKILGGVKTFFKGALKELASTYLQ |
21 | AP00090 | P80400 | Gaegurin-6  |http://aps.unmc.edu/AP/database/query_output.php?ID=00090 | FLPLLAGLAANFLPTIICKISYKC |
22 | AP00101 | P57104 | Temporin L | http://aps.unmc.edu/AP/database/query_output.php?ID=00101 | FVQWFSKFLGRIL |
23 | AP00128 | P01509 | Cecropin B | http://aps.unmc.edu/AP/database/query_output.php?ID=00128 | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL |
24 | AP00135 | Q06590 | Cecropin2 | http://aps.unmc.edu/AP/database/query_output.php?ID=00135 | GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK |
25 | AP00139 | P01507 | Cecropin A | http://aps.unmc.edu/AP/database/query_output.php?ID=00139 | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
26 | AP00140 | Ref | SK84 | http://aps.unmc.edu/AP/database/query_output.php?ID=00140 |...
tracking img